Sign In | Join Free | My burrillandco.com
Home > Growth Hormone Peptides >

2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder

Shanghai Stero R&D Co,. Ltd
Trust Seal
Verified Supplier
Credit Check
Supplier Assessment
Shanghai Stero R&D Co,. Ltd
City: Shanghai
Province/State: Shanghai
Country/Region: China
Tel: 86-170-98666737
Contact Person:
Mr Deca Lee
    Buy cheap 2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder from wholesalers
     
    Buy cheap 2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder from wholesalers
    • Buy cheap 2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder from wholesalers

    2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder

    Ask Lasest Price
    Brand Name : Shanghai Stero
    Model Number : Cjc1295
    Certification : GMP, BP , HSE , ISO9001 , USP
    Price : Negotiation
    Payment Terms : L/C, D/A, D/P, T/T, Western Union, MoneyGram, Bitcoin
    Supply Ability : 1000Kits Per month
    Delivery Time : 3-5 days
    • Product Details
    • Company Profile

    2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder


    2Mg Per Vial Growth Hormone Peptides Cjc1295 Without Dac Cjc1295 Dac


    CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a growth hormone releasing hormone (GHRH) analog.


    Clinical Research was first conducted for CJC-1295 during the mid-2000s. The objective of the peptide was to treat visceral fat deposits in obese AIDS patients, as increased levels of exogenous hgH are presumed to increase lipolysis (fat loss). The clinical research was ultimately successful for most research subjects


    SequenceH-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
    Molecular FormulaC152H252N44O42
    One Letter SequenceY(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
    Physical Apperancewhite powder
    Form & FormulationsSterile Filtered white lyophilized (freeze-dried)
    Stability2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, 20 to 70 °C under sterile conditions after reconstitution.
    Suitabilitysuitable for cell culture and animal experiment
    Purity>98% by RP-HPLC
    StorageStore at -20°C. Product is guaranteed 2 years from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.

    Recommended Cjc1295 Dac Dosages

    The second most potent fat loss peptide is CJC-1295 DAC since it causes the overall GH level to rise in the body. The most potent being


    Modified GRF 1-29 Dose per injection: 100mcg Injections per vial: 20 x 100mcg dosages Amount to Inject: If you have used 1ml of water for mixing then a 100mcg dosage = 0.05ml (or 5 units on Insulin Syringe). If you have used 2ml of water for mixing then 100mcg = 0.10ml (or 10 units) and if you have used 3ml of water for mixing, then 100mcg = 0.15ml (or 15 units).


    CJC-1295 DAC Dose per injection: 2mg Injections per vial: 1 x 2mg dosages Amount to Inject: If you have used 0.5ml of water for mixing then a 2mg dosage = 0.50ml (or 50 units on Insulin Syringe). If you have used 1ml of water then a 2mg dosage = 1ml (or 100 units).


    CJC-1295 DAC Results

    CJC-1295 has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. In animal studies it has been shown that CJC-1295 with DAC can increase growth hormone and IGF-I secretion and effects, and it can do this in very large amounts. CJC-1295 with DAC Stimulates GH and IGF-1 Secretion, and will keep a steady increase of growth hormone and IGF-1 with no increase in prolactin, leading to intense fat loss, and increases protein synthesis for more muscle growth and repair.


    CJC 1295 AND BODYBUILDING

    After adolescent growth is complete, natural secretion of HGH begins to decline and it becomes harder to build lean muscle mass. HGH injections have helped children who were deficient in growth hormone reach a normal size, and in 1985 a synthetic version was created. Since then, countless studies have detailed the changes HGH can have in an adult body including increased muscle mass, and decreased body fat. While some doctors and clinics will sometimes prescribe HGH for the off label uses like bodybuilding, the cost, difficulty, and side effects keep the majority of adults who are GH deficient from getting supplemented. In contrast, research shows that CJC 1295 once a week will increase mean plasma GH concentrations by 2-10 fold for more than 6 days, and increase IGF (Insulin growth factor) concentrations 1.5-3 fold for 9-11 days with no serious adverse effects. For bodybuilders, weekend warriors, and even just moms trying to stay fit, higher levels of growth hormone can feel like a proverbial fountain of youth (but it’s really all about the peptides!).


    Method of administration

    Mostly, these peptides are sold as lyophilized powder in 2mg containers. Bacteriostatic water should be mixed with the powder in order to reconstitute it. To make the dosage of 100mcg per injection, 2ml bacteriostatic water should be mixed into 2mg of lyophilized powder. This reconstituted mixture should be then injected inside the muscles or under the skin. The mixture should be kept under refrigeration at all times otherwise it will degenerate and will not be effective anymore.



    Our Peptides Products List
    Peptides NameSpecification
    CJC-12932mg/Vial, 10Vials/kit
    CJC-12952mg/Vial, 10Vials/kit
    CJC-1295 DAC (Drug Affinity Complex)2mg/Vial, 10Vials/kit
    GHRP-2 (Pralmorelin)10mg/Vial, 10Vials/kit
    GHRP-2 (Pralmorelin)5mg/Vial, 10Vials/kit
    GHRP-6 (Growth hormone releasing peptide)10mg/Vial, 10Vials/kit
    GHRP-6 (Growth hormone releasing peptide)5mg/Vial, 10Vials/kit
    Melanotan-1(MT1)10mg/Vial, 10Vials/kit
    Melanotan-2 (MT2)10mg/Vial, 10Vials/kit
    Bremelanotide (PT-141)5mg/Vial, 10Vials/kit
    MGF(mast cell growth factor)2mg/Vial, 10Vials/kit
    PEG-MGF2mg/Vial, 10Vials/kit
    HGH Frag 176-1912mg/Vial, 10Vials/kit
    HGH 99.7% (Red, Yellow, Blue, Green Tops)10IU/Vial, 10Vials/Kit
    KIGTROPIN10IU/Vial, 10Vials/Kit
    JINTROPIN10IU/Vial, 10Vials/Kit
    RIPTROPIN10IU/Vial, 10Vials/Kit
    HYGETROPIN10IU/Vial, 10Vials/Kit
    HYGETROPIN8IU/Vial, 25Vials/Kit
    GETROPIN10IU/Vial, 10Vials/Kit
    ANSOMONE10IU/Vial, 10Vials/Kit
    HCG5000IU/Vial, 10Vials/Kit
    EPO Suspension3000IU/Vial, 5Vials/Kit
    EPO Powder3000IU/Vial, 5Vials/Kit
    HMG75IU/Vial, 6Vials/Kit
    IGF1 Des1-31mg/Vial, 10Vials/Kit
    IGF1 LR30.1mg/Vial, 10Vials/Kit
    IGF1 LR31mg/Vial, 10Vials/Kit
    Oxytocin Acetate; Oxtocin2mg/Vial, 10Vials/kit
    Thymosin β4 Acetate (TB500)2mg/Vial, 10Vials/kit
    Alarelin2mg/Vial, 10Vials/kit
    Hexarelin Acetate2mg/Vial, 10Vials/kit
    Hexarelin Acetate5mg/Vial, 10Vials/kit
    Ipamorelin2mg/Vial, 10Vials/kit
    Ipamorelin5mg/Vial, 10Vials/kit
    Egrifta(Tesamorelin)2mg/Vial, 10Vials/kit
    Leuprorelin Acetate; Leuprolide2mg/Vial, 10Vials/kit
    Sermorelin Acetate2mg/Vial, 10Vials/kit
    Triptorelin Acetate2mg/Vial, 10Vials/kit
    DSIP (Delta sleep-inducing peptide)2mg/Vial, 10Vials/kit
    Gonadorelin2mg/Vial, 10Vials/kit
    Gonadorelin10mg/Vial, 10Vials/kit
    Selank5mg/Vial, 10Vials/kit
    Novolin 30R (Isophane Protamine Biosynthetic Human Insulin Injection)300iu/Vial, 200Vials/Caton
    Adenosine Disodium Triphosphate, Coenzyme A and Insulin for Injection

    1500Vials/Caton



    Our Services To You
    Fast DeliveryDelivery within 24 hours upon receipt of your payment
    QualityQuality can be promised. Hot sell to Worldwide
    Payment TermsT/T ,Bank Transfer, Western Union, Paypal, Bitcoin and M money Gram Available
    SampleSample available at any time
    Tracking your at any timeInform your order's further new situation at any time
    PackageProfessional packing with professional materials
    PO boxesAvailable
    Reshipwe have one full-reship policy

    Quality 2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder for sale
    Inquiry Cart 0
    Send your message to this supplier
     
    From:
    Enter your email please.
    To: Shanghai Stero R&D Co,. Ltd
    Subject:
    Message:
    Characters Remaining: (0/3000)
     

    Home| Products| Suppliers| Quality Suppliers| Site Map |About Us |Contact Us |Help |关于我们 |联系我们

    Copyright © 2009 - 2018 burrillandco.com. All rights reserved.